PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc00g099580.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HB-other
Protein Properties Length: 460aa    MW: 50482.5 Da    PI: 7.6745
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc00g099580.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-1963118156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e++F+++++p+ ++r+eL k+lgL+  qVk+WFqN+R+++k
  Solyc00g099580.1.1  63 KKRYHRHTQLQIQEMESFFKECPHPDDKQRKELGKRLGLEPLQVKFWFQNKRTQMK 118
                         688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2147118IPR009057Homeodomain-like
SuperFamilySSF466892.27E-1849118IPR009057Homeodomain-like
PROSITE profilePS5007116.08260120IPR001356Homeobox domain
SMARTSM003894.9E-1761124IPR001356Homeobox domain
CDDcd000866.14E-1863118No hitNo description
PfamPF000463.3E-1763118IPR001356Homeobox domain
SuperFamilySSF562352.65E-102142459IPR029055Nucleophile aminohydrolases, N-terminal
PfamPF010193.2E-94164459IPR000101Gamma-glutamyltranspeptidase
PRINTSPR012106.7E-36171196IPR000101Gamma-glutamyltranspeptidase
PRINTSPR012106.7E-36246264IPR000101Gamma-glutamyltranspeptidase
PRINTSPR012106.7E-36264283IPR000101Gamma-glutamyltranspeptidase
PRINTSPR012106.7E-36365381IPR000101Gamma-glutamyltranspeptidase
PRINTSPR012106.7E-36395414IPR000101Gamma-glutamyltranspeptidase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006749Biological Processglutathione metabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003840Molecular Functiongamma-glutamyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MFQPNMFESH HHLLDMSHKS PENDLDLLRD NDEFESKSMA DIMENNPCDD DQEVDPNQRP  60
NKKKRYHRHT QLQIQEMESF FKECPHPDDK QRKELGKRLG LEPLQVKFWF QNKRTQMKGR  120
ANVARMIKRL LAAASFFLLA IPSLAAAQGV TSSADPRATE AGREILHQGG SAADAAVAMV  180
AVLTLVEPQS SGIGGGGFMV YHNAGDGSIS TIDGRETAPA AAKPDRFLGP DGKPRGYMDV  240
IPGGLSVGVP GNVRLMEMAH KKWGKLEWKA LFQPAIKLAE EGYQVTPALN SWLVQFEPMW  300
KEFPAARAIY YVDGKPAPVG TTIRNPAYAA ILRDIAARGP EAFYTGANAK AISDAVAKAP  360
RNPSQLTLKD LAAYKAKERP AVCTTYRIYK VCGMGPPSSG AATVFGILGM LEAYDMKAMG  420
KDNPMSWHLL AEAMQLAYAD RAAYLGDSDF VDVPVQGLLX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4otu_A2e-6114945943349Gamma glutamyl transpeptidase
4ott_A2e-6114945943349Gamma glutamyl transpeptidase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGSolyc00g099580.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2584822
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.22e-48HD-ZIP family protein